SCOPe 2.08: Domain d3fdzb_: 3fdz B:

Lineage for d3fdzb_ (3fdz B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [188661] (3 PDB entries)

8. Domain d3fdzb_: 3fdz B: [175718]
   automated match to d1e59a_
   complexed with 3pg, dg2, peg

Details for d3fdzb_

PDB Entry: 3fdz, 2.25 Å

PDB Description: crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid

PDB Compounds: (B:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d3fdzb_:

Sequence; same for both SEQRES and ATOM records:

>d3fdzb_ c.60.1.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr
airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp
ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia
ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylg

Timeline for d3fdzb_:

• d3fdzb_ first appeared in SCOPe 2.01
  
• d3fdzb_ appears in SCOPe 2.07