SCOPe 2.04: Domain d3fcua_: 3fcu A:

Lineage for d3fcua_ (3fcu A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families)

5. Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)

6. Protein Integrin alpha N-terminal domain [69320] (2 species)

7. Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (17 PDB entries)
   Uniprot P08514 32-483

8. Domain d3fcua_: 3fcu A: [175690]
   automated match to d1tyea_
   complexed with ca, cac, mg, nag

Details for d3fcua_

PDB Entry: 3fcu, 2.9 Å

PDB Description: structure of headpiece of integrin aiibb3 in open conformation

PDB Compounds: (A:) Integrin, alpha 2b

SCOPe Domain Sequences for d3fcua_:

Sequence; same for both SEQRES and ATOM records:

>d3fcua_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqpvvkas

Timeline for d3fcua_:

• d3fcua_ first appeared in SCOPe 2.01
  
• d3fcua_ appears in SCOPe 2.03
  
• d3fcua_ appears in SCOPe 2.05
  
• d3fcua_ appears in the current release, SCOPe 2.08