Lineage for d3fcoa_ (3fco A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 975463Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 975479Species Human (Homo sapiens) [TaxId:9606] [117424] (19 PDB entries)
    Uniprot P28845
  8. 975535Domain d3fcoa_: 3fco A: [175688]
    automated match to d1xu9a_
    complexed with iig, nap

Details for d3fcoa_

PDB Entry: 3fco (more details), 2.65 Å

PDB Description: crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with benzamide inhibitor
PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d3fcoa_:

Sequence, based on SEQRES records: (download)

>d3fcoa_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
ysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyds
slwttllirnpsrkileflystsynmdrf

Sequence, based on observed residues (ATOM records): (download)

>d3fcoa_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
ysvsrvnvsitlcvlglidtetamkavsghmqaapkeecaleiikggalrqeevyydssl
wttllirnpsrkileflystsynmdrf

SCOPe Domain Coordinates for d3fcoa_:

Click to download the PDB-style file with coordinates for d3fcoa_.
(The format of our PDB-style files is described here.)

Timeline for d3fcoa_: