Lineage for d3fcdb_ (3fcd B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200465Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1200466Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1200824Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 1200825Protein automated matches [190239] (6 species)
    not a true protein
  7. 1200842Species Uncultured bacterium [TaxId:77133] [188712] (1 PDB entry)
  8. 1200844Domain d3fcdb_: 3fcd B: [175686]
    automated match to d1jiea_

Details for d3fcdb_

PDB Entry: 3fcd (more details), 1.92 Å

PDB Description: crystal structure of a putative glyoxalase from an environmental bacteria
PDB Compounds: (B:) Lyase

SCOPe Domain Sequences for d3fcdb_:

Sequence, based on SEQRES records: (download)

>d3fcdb_ d.32.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
ihqitpflhipdmqealtlfcdtlgfelkyrhsnyaylelsgcglrlleeparkiipdgi
arvaicidvsdidslhtklspalenlpadqveplknmpygqrefqvrmpdgdwlnftapl
aeghhhhh

Sequence, based on observed residues (ATOM records): (download)

>d3fcdb_ d.32.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
ihqitpflhipdmqealtlfcdtlgfelkyrhsnyaylelsgcglrlleeparvaicidv
sdidslhtklspalenlpadqveplknmpygqrefqvrmpdgdwlnftaplaeghhhhh

SCOPe Domain Coordinates for d3fcdb_:

Click to download the PDB-style file with coordinates for d3fcdb_.
(The format of our PDB-style files is described here.)

Timeline for d3fcdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fcda_