Lineage for d11gsa1 (11gs A:77-209)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281527Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 281528Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 281529Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 281725Protein Class pi GST [81347] (3 species)
  7. 281726Species Human (Homo sapiens) [TaxId:9606] [47619] (35 PDB entries)
  8. 281790Domain d11gsa1: 11gs A:77-209 [17568]
    Other proteins in same PDB: d11gsa2, d11gsb2

Details for d11gsa1

PDB Entry: 11gs (more details), 2.3 Å

PDB Description: Glutathione s-transferase complexed with ethacrynic acid-glutathione conjugate (form ii)

SCOP Domain Sequences for d11gsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d11gsa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d11gsa1:

Click to download the PDB-style file with coordinates for d11gsa1.
(The format of our PDB-style files is described here.)

Timeline for d11gsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d11gsa2