SCOPe 2.08: Domain d11gsa1: 11gs A:77-209

Lineage for d11gsa1 (11gs A:77-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries)

8. Domain d11gsa1: 11gs A:77-209 [17568]
   Other proteins in same PDB: d11gsa2, d11gsb2
   complexed with eaa, gsh, mes

Details for d11gsa1

PDB Entry: 11gs, 2.3 Å

PDB Description: Glutathione s-transferase complexed with ethacrynic acid-glutathione conjugate (form ii)

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d11gsa1:

Sequence; same for both SEQRES and ATOM records:

>d11gsa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d11gsa1:

• d11gsa1 first appeared (with stable ids) in SCOP 1.55
  
• d11gsa1 appears in SCOPe 2.07