SCOPe 2.06: Domain d7gssb1: 7gss B:77-209

Lineage for d7gssb1 (7gss B:77-209)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (63 PDB entries)

8. Domain d7gssb1: 7gss B:77-209 [17567]
   Other proteins in same PDB: d7gssa2, d7gssb2
   complexed with gsh, mes

Details for d7gssb1

PDB Entry: 7gss, 2.2 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione

PDB Compounds: (B:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d7gssb1:

Sequence; same for both SEQRES and ATOM records:

>d7gssb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d7gssb1:

• d7gssb1 first appeared (with stable ids) in SCOP 1.55
  
• d7gssb1 appears in SCOPe 2.05
  
• d7gssb1 appears in SCOPe 2.07
  
• d7gssb1 appears in the current release, SCOPe 2.08