Lineage for d1aqxc1 (1aqx C:77-209)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 642036Protein Class pi GST [81347] (4 species)
  7. 642037Species Human (Homo sapiens) [TaxId:9606] [47619] (39 PDB entries)
  8. 642101Domain d1aqxc1: 1aqx C:77-209 [17564]
    Other proteins in same PDB: d1aqxa2, d1aqxb2, d1aqxc2, d1aqxd2

Details for d1aqxc1

PDB Entry: 1aqx (more details), 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex
PDB Compounds: (C:) glutathione s-transferase

SCOP Domain Sequences for d1aqxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqxc1 a.45.1.1 (C:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d1aqxc1:

Click to download the PDB-style file with coordinates for d1aqxc1.
(The format of our PDB-style files is described here.)

Timeline for d1aqxc1: