SCOPe 2.04: Domain d1aqxb1: 1aqx B:77-209

Lineage for d1aqxb1 (1aqx B:77-209)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries)

8. Domain d1aqxb1: 1aqx B:77-209 [17563]
   Other proteins in same PDB: d1aqxa2, d1aqxb2, d1aqxc2, d1aqxd2
   complexed with gtd, mes

Details for d1aqxb1

PDB Entry: 1aqx, 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1aqxb1:

Sequence; same for both SEQRES and ATOM records:

>d1aqxb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d1aqxb1:

• d1aqxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1aqxb1 appears in SCOPe 2.03
  
• d1aqxb1 appears in SCOPe 2.05
  
• d1aqxb1 appears in the current release, SCOPe 2.08