Lineage for d1aqxb1 (1aqx B:77-209)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443617Protein Class pi GST [81347] (3 species)
  7. 443618Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)
  8. 443671Domain d1aqxb1: 1aqx B:77-209 [17563]
    Other proteins in same PDB: d1aqxa2, d1aqxb2, d1aqxc2, d1aqxd2

Details for d1aqxb1

PDB Entry: 1aqx (more details), 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1aqxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqxb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d1aqxb1:

Click to download the PDB-style file with coordinates for d1aqxb1.
(The format of our PDB-style files is described here.)

Timeline for d1aqxb1: