![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.8: SMR domain-like [160443] (1 family) ![]() automatically mapped to Pfam PF01713 |
![]() | Family d.68.8.1: Smr domain [160444] (2 proteins) Pfam PF01713 |
![]() | Protein automated matches [191106] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189140] (1 PDB entry) |
![]() | Domain d3faud1: 3fau D:11-90 [175625] Other proteins in same PDB: d3faua2, d3faub2, d3fauc2, d3faud2 automated match to d2d9ia1 |
PDB Entry: 3fau (more details), 1.9 Å
SCOPe Domain Sequences for d3faud1:
Sequence, based on SEQRES records: (download)
>d3faud1 d.68.8.1 (D:11-90) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpavikyl ishsfrfseikpgclkvmlk
>d3faud1 d.68.8.1 (D:11-90) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgsqggvarikpavikylis hsfrfseikpgclkvmlk
Timeline for d3faud1: