Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.8: SMR domain-like [160443] (1 family) automatically mapped to Pfam PF01713 |
Family d.68.8.1: Smr domain [160444] (2 proteins) Pfam PF01713 |
Protein automated matches [191106] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189140] (1 PDB entry) |
Domain d3faub1: 3fau B:11-90 [175623] Other proteins in same PDB: d3faua2, d3faub2, d3fauc2, d3faud2 automated match to d2d9ia1 |
PDB Entry: 3fau (more details), 1.9 Å
SCOPe Domain Sequences for d3faub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3faub1 d.68.8.1 (B:11-90) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpavikyl ishsfrfseikpgclkvmlk
Timeline for d3faub1: