Lineage for d3faub1 (3fau B:11-90)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199715Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2200123Superfamily d.68.8: SMR domain-like [160443] (1 family) (S)
    automatically mapped to Pfam PF01713
  5. 2200124Family d.68.8.1: Smr domain [160444] (2 proteins)
    Pfam PF01713
  6. 2200128Protein automated matches [191106] (1 species)
    not a true protein
  7. 2200129Species Human (Homo sapiens) [TaxId:9606] [189140] (1 PDB entry)
  8. 2200131Domain d3faub1: 3fau B:11-90 [175623]
    Other proteins in same PDB: d3faua2, d3faub2, d3fauc2, d3faud2
    automated match to d2d9ia1

Details for d3faub1

PDB Entry: 3fau (more details), 1.9 Å

PDB Description: crystal structure of human small-muts related domain
PDB Compounds: (B:) NEDD4-binding protein 2

SCOPe Domain Sequences for d3faub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3faub1 d.68.8.1 (B:11-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpavikyl
ishsfrfseikpgclkvmlk

SCOPe Domain Coordinates for d3faub1:

Click to download the PDB-style file with coordinates for d3faub1.
(The format of our PDB-style files is described here.)

Timeline for d3faub1: