Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.8: SMR domain-like [160443] (1 family) |
Family d.68.8.1: Smr domain [160444] (2 proteins) Pfam PF01713 |
Protein automated matches [191106] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189140] (1 PDB entry) |
Domain d3faub_: 3fau B: [175623] automated match to d2d9ia1 |
PDB Entry: 3fau (more details), 1.9 Å
SCOPe Domain Sequences for d3faub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3faub_ d.68.8.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpaviky lishsfrfseikpgclkvmlk
Timeline for d3faub_: