SCOPe 2.01: Domain d3faub_: 3fau B:

Lineage for d3faub_ (3fau B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.8: SMR domain-like [160443] (1 family)

5. Family d.68.8.1: Smr domain [160444] (2 proteins)
   Pfam PF01713

6. Protein automated matches [191106] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189140] (1 PDB entry)

8. Domain d3faub_: 3fau B: [175623]
   automated match to d2d9ia1

Details for d3faub_

PDB Entry: 3fau, 1.9 Å

PDB Description: crystal structure of human small-muts related domain

PDB Compounds: (B:) NEDD4-binding protein 2

SCOPe Domain Sequences for d3faub_:

Sequence; same for both SEQRES and ATOM records:

>d3faub_ d.68.8.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpaviky
lishsfrfseikpgclkvmlk

Timeline for d3faub_:

• d3faub_ is new in SCOPe 2.01-stable
  
• d3faub_ appears in SCOPe 2.02
  
• d3faub_ appears in the current release, SCOPe 2.08, called d3faub1