Lineage for d3f9rb1 (3f9r B:2-246)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920681Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188800] (1 PDB entry)
  8. 2920683Domain d3f9rb1: 3f9r B:2-246 [175603]
    Other proteins in same PDB: d3f9ra2, d3f9rb2
    automated match to d2amya1
    complexed with mg, so4

Details for d3f9rb1

PDB Entry: 3f9r (more details), 1.85 Å

PDB Description: crystal structure of trypanosoma brucei phosphomannosemutase, tb.10.700.370
PDB Compounds: (B:) Phosphomannomutase

SCOPe Domain Sequences for d3f9rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f9rb1 c.108.1.0 (B:2-246) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mkrvlllfdvdgtltpprlcqtdemralikrargagfcvgtvggsdfakqveqlgrdvlt
qfdyvfaengllayrngleihrqsllnalgndrivkfvkktlrliadldipvqrgtfvey
rngminvspigrncsqaerdefevydnehrvrasliaelensfpdfglkysiggqisfdv
fpvgwdktyclqfveddfeeihffgdktqeggndyeiytdkrtighkvtsykdtiaevek
iiamk

SCOPe Domain Coordinates for d3f9rb1:

Click to download the PDB-style file with coordinates for d3f9rb1.
(The format of our PDB-style files is described here.)

Timeline for d3f9rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f9rb2