Lineage for d12gsb1 (12gs B:77-209)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356194Protein Class pi GST [81347] (3 species)
  7. 356195Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)
  8. 356274Domain d12gsb1: 12gs B:77-209 [17559]
    Other proteins in same PDB: d12gsa2, d12gsb2
    complexed with gt9, mes

Details for d12gsb1

PDB Entry: 12gs (more details), 2.1 Å

PDB Description: glutathione s-transferase complexed with s-nonyl-glutathione

SCOP Domain Sequences for d12gsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d12gsb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d12gsb1:

Click to download the PDB-style file with coordinates for d12gsb1.
(The format of our PDB-style files is described here.)

Timeline for d12gsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d12gsb2