Lineage for d3f88b_ (3f88 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1042959Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 1042960Species Human (Homo sapiens) [TaxId:9606] [69824] (21 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 1042989Domain d3f88b_: 3f88 B: [175563]
    automated match to d1gngb_
    complexed with 2ht, 3ht

Details for d3f88b_

PDB Entry: 3f88 (more details), 2.6 Å

PDB Description: glycogen synthase kinase 3beta inhibitor complex
PDB Compounds: (B:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d3f88b_:

Sequence, based on SEQRES records: (download)

>d3f88b_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgekkdvvylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar

Sequence, based on observed residues (ATOM records): (download)

>d3f88b_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvkl
ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
iremnpnefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffde
lrdpnvklpngrdtpalfnfttqelssnpplatilipphar

SCOPe Domain Coordinates for d3f88b_:

Click to download the PDB-style file with coordinates for d3f88b_.
(The format of our PDB-style files is described here.)

Timeline for d3f88b_: