SCOP 1.67: Domain d4pgtb1: 4pgt B:77-209

Lineage for d4pgtb1 (4pgt B:77-209)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class pi GST [81347] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)

8. Domain d4pgtb1: 4pgt B:77-209 [17555]
   Other proteins in same PDB: d4pgta2, d4pgtb2
   complexed with gbx, mes, so4; mutant

Details for d4pgtb1

PDB Entry: 4pgt, 2.1 Å

PDB Description: crystal structure of hgstp1-1[v104] complexed with the gsh conjugate of (+)-anti-bpde

SCOP Domain Sequences for d4pgtb1:

Sequence; same for both SEQRES and ATOM records:

>d4pgtb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d4pgtb1:

• d4pgtb1 first appeared (with stable ids) in SCOP 1.55
  
• d4pgtb1 appears in SCOP 1.65
  
• d4pgtb1 appears in SCOP 1.69
  
• d4pgtb1 appears in the current release, SCOPe 2.08