Lineage for d3f7oa_ (3f7o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873828Family c.41.1.0: automated matches [191390] (1 protein)
    not a true family
  6. 2873829Protein automated matches [190500] (10 species)
    not a true protein
  7. 2873837Species Paecilomyces lilacinus [TaxId:33203] [189113] (1 PDB entry)
  8. 2873838Domain d3f7oa_: 3f7o A: [175549]
    automated match to d1ic6a_
    complexed with ca, hmb

Details for d3f7oa_

PDB Entry: 3f7o (more details), 2.2 Å

PDB Description: Crystal structure of Cuticle-Degrading Protease from Paecilomyces lilacinus (PL646)
PDB Compounds: (A:) serine protease

SCOPe Domain Sequences for d3f7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7oa_ c.41.1.0 (A:) automated matches {Paecilomyces lilacinus [TaxId: 33203]}
aytqqpgapwglgrishrskgsttyeydtsggsgtcayvidtgveashpefegrasqiks
fisgqntdgnghgthcagtigsktygvakktkiygvkvldnsgsgsysgiisgmdfavqd
sksrscpkgvvanmslgggkaqsvndgaaamiragvflavaagndnanaanyspaseptv
ctvgattssdarssfsnygnlvdifapgsnilstwiggttntisgtsmatphivglgayl
aglegfpgaqalckriqtlstknvltgipsgtvnylafngnpsg

SCOPe Domain Coordinates for d3f7oa_:

Click to download the PDB-style file with coordinates for d3f7oa_.
(The format of our PDB-style files is described here.)

Timeline for d3f7oa_: