Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.0: automated matches [191390] (1 protein) not a true family |
Protein automated matches [190500] (10 species) not a true protein |
Species Paecilomyces lilacinus [TaxId:33203] [189113] (1 PDB entry) |
Domain d3f7oa_: 3f7o A: [175549] automated match to d1ic6a_ complexed with ca, hmb |
PDB Entry: 3f7o (more details), 2.2 Å
SCOPe Domain Sequences for d3f7oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f7oa_ c.41.1.0 (A:) automated matches {Paecilomyces lilacinus [TaxId: 33203]} aytqqpgapwglgrishrskgsttyeydtsggsgtcayvidtgveashpefegrasqiks fisgqntdgnghgthcagtigsktygvakktkiygvkvldnsgsgsysgiisgmdfavqd sksrscpkgvvanmslgggkaqsvndgaaamiragvflavaagndnanaanyspaseptv ctvgattssdarssfsnygnlvdifapgsnilstwiggttntisgtsmatphivglgayl aglegfpgaqalckriqtlstknvltgipsgtvnylafngnpsg
Timeline for d3f7oa_: