Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries) Uniprot P20701 153-334 |
Domain d3f74b_: 3f74 B: [175536] automated match to d1cqpa_ complexed with gol, mg |
PDB Entry: 3f74 (more details), 1.7 Å
SCOPe Domain Sequences for d3f74b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f74b_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
Timeline for d3f74b_: