Lineage for d3f6pa_ (3f6p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855710Protein automated matches [190177] (9 species)
    not a true protein
  7. 2855714Species Bacillus subtilis [TaxId:224308] [189247] (1 PDB entry)
  8. 2855715Domain d3f6pa_: 3f6p A: [175513]
    automated match to d1nxoa_

Details for d3f6pa_

PDB Entry: 3f6p (more details), 1.95 Å

PDB Description: crystal structure of unphosphorelated receiver domain of yycf
PDB Compounds: (A:) Transcriptional regulatory protein yycF

SCOPe Domain Sequences for d3f6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f6pa_ c.23.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
mdkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkd
gvevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrq

SCOPe Domain Coordinates for d3f6pa_:

Click to download the PDB-style file with coordinates for d3f6pa_.
(The format of our PDB-style files is described here.)

Timeline for d3f6pa_: