Lineage for d3f4cb_ (3f4c B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 972129Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 972130Protein automated matches [190150] (10 species)
    not a true protein
  7. 972140Species Geobacillus stearothermophilus [TaxId:272567] [188974] (2 PDB entries)
  8. 972142Domain d3f4cb_: 3f4c B: [175457]
    automated match to d2d2ga1
    complexed with co, gol

Details for d3f4cb_

PDB Entry: 3f4c (more details), 2.07 Å

PDB Description: Crystal structure of organophosphorus hydrolase from Geobacillus stearothermophilus strain 10, with glycerol bound
PDB Compounds: (B:) Organophosphorus hydrolase

SCOPe Domain Sequences for d3f4cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f4cb_ c.1.9.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
ktvetvlgpvpveqlgktlihehflfgypgfqgdvtrgtfredealrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd
eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfsa

SCOPe Domain Coordinates for d3f4cb_:

Click to download the PDB-style file with coordinates for d3f4cb_.
(The format of our PDB-style files is described here.)

Timeline for d3f4cb_: