SCOP 1.73: Domain d22gsa1: 22gs A:77-209

Lineage for d22gsa1 (22gs A:77-209)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (39 PDB entries)

8. Domain d22gsa1: 22gs A:77-209 [17542]
   Other proteins in same PDB: d22gsa2, d22gsb2

Details for d22gsa1

PDB Entry: 22gs, 1.9 Å

PDB Description: human glutathione s-transferase p1-1 y49f mutant

PDB Compounds: (A:) glutathione s-transferase p1-1

SCOP Domain Sequences for d22gsa1:

Sequence; same for both SEQRES and ATOM records:

>d22gsa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d22gsa1:

• d22gsa1 first appeared (with stable ids) in SCOP 1.55
  
• d22gsa1 appears in SCOP 1.71
  
• d22gsa1 appears in SCOP 1.75
  
• d22gsa1 appears in the current release, SCOPe 2.08