Lineage for d3gssa1 (3gss A:77-209)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 97963Protein Glutathione S-transferase [47618] (24 species)
  7. 98034Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (30 PDB entries)
  8. 98064Domain d3gssa1: 3gss A:77-209 [17538]
    Other proteins in same PDB: d3gssa2, d3gssb2

Details for d3gssa1

PDB Entry: 3gss (more details), 1.9 Å

PDB Description: human glutathione s-transferase p1-1 in complex with ethacrynic acid-glutathione conjugate

SCOP Domain Sequences for d3gssa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gssa1 a.45.1.1 (A:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d3gssa1:

Click to download the PDB-style file with coordinates for d3gssa1.
(The format of our PDB-style files is described here.)

Timeline for d3gssa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gssa2