Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.8: Atu1531-like [160742] (3 proteins) Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport |
Protein automated matches [190981] (1 species) not a true protein |
Species Bacillus thuringiensis [TaxId:180856] [188667] (1 PDB entry) |
Domain d3f08b_: 3f08 B: [175376] automated match to d3cnwa1 |
PDB Entry: 3f08 (more details), 2.2 Å
SCOPe Domain Sequences for d3f08b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f08b_ d.129.3.8 (B:) automated matches {Bacillus thuringiensis [TaxId: 180856]} mahtttsmeifgsteqvwqliggfnslpdwlpyipssklteggrvrhlanpdgetiierl evfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvavsdeeainl vhgiysdglkalqhafld
Timeline for d3f08b_: