SCOPe 2.01: Domain d3f08b_: 3f08 B:

Lineage for d3f08b_ (3f08 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.8: Atu1531-like [160742] (3 proteins)
   Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport

6. Protein automated matches [190981] (1 species)
   not a true protein

7. Species Bacillus thuringiensis [TaxId:180856] [188667] (1 PDB entry)

8. Domain d3f08b_: 3f08 B: [175376]
   automated match to d3cnwa1

Details for d3f08b_

PDB Entry: 3f08, 2.2 Å

PDB Description: crystal structure of the putative uncharacterized protein q6hg14 from bacilllus thuringiensis. northeast structural genomics consortium target bur153.

PDB Compounds: (B:) uncharacterized protein Q6HG14

SCOPe Domain Sequences for d3f08b_:

Sequence; same for both SEQRES and ATOM records:

>d3f08b_ d.129.3.8 (B:) automated matches {Bacillus thuringiensis [TaxId: 180856]}
mahtttsmeifgsteqvwqliggfnslpdwlpyipssklteggrvrhlanpdgetiierl
evfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvavsdeeainl
vhgiysdglkalqhafld

Timeline for d3f08b_:

• d3f08b_ is new in SCOPe 2.01-stable
  
• d3f08b_ appears in SCOPe 2.02
  
• d3f08b_ appears in the current release, SCOPe 2.08