![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.8: Atu1531-like [160742] (3 proteins) Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport |
![]() | Protein automated matches [190981] (1 species) not a true protein |
![]() | Species Bacillus thuringiensis [TaxId:180856] [188667] (1 PDB entry) |
![]() | Domain d3f08a_: 3f08 A: [175375] automated match to d3cnwa1 |
PDB Entry: 3f08 (more details), 2.2 Å
SCOPe Domain Sequences for d3f08a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f08a_ d.129.3.8 (A:) automated matches {Bacillus thuringiensis [TaxId: 180856]} ahtttsmeifgsteqvwqliggfnslpdwlpyipssklteggrvrhlanpdgetiierle vfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvavsdeeainlv hgiysdglkalqhafld
Timeline for d3f08a_: