Lineage for d3f08a_ (3f08 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218323Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1218536Family d.129.3.8: Atu1531-like [160742] (3 proteins)
    Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport
  6. 1218545Protein automated matches [190981] (1 species)
    not a true protein
  7. 1218546Species Bacillus thuringiensis [TaxId:180856] [188667] (1 PDB entry)
  8. 1218547Domain d3f08a_: 3f08 A: [175375]
    automated match to d3cnwa1

Details for d3f08a_

PDB Entry: 3f08 (more details), 2.2 Å

PDB Description: crystal structure of the putative uncharacterized protein q6hg14 from bacilllus thuringiensis. northeast structural genomics consortium target bur153.
PDB Compounds: (A:) uncharacterized protein Q6HG14

SCOPe Domain Sequences for d3f08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f08a_ d.129.3.8 (A:) automated matches {Bacillus thuringiensis [TaxId: 180856]}
ahtttsmeifgsteqvwqliggfnslpdwlpyipssklteggrvrhlanpdgetiierle
vfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvavsdeeainlv
hgiysdglkalqhafld

SCOPe Domain Coordinates for d3f08a_:

Click to download the PDB-style file with coordinates for d3f08a_.
(The format of our PDB-style files is described here.)

Timeline for d3f08a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3f08b_