SCOPe 2.06: Domain d3f03k_: 3f03 K:

Lineage for d3f03k_ (3f03 K:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Pentaerythritol tetranirate reductase [63900] (1 species)

7. Species Enterobacter cloacae [TaxId:550] [63901] (29 PDB entries)
   Uniprot P71278

8. Domain d3f03k_: 3f03 K: [175370]
   automated match to d1gvra_
   complexed with cl, fmn, ipa, nyh

Details for d3f03k_

PDB Entry: 3f03, 1.34 Å

PDB Description: Crystal structure of Pentaerythritol Tetranitrate Reductase complex with 1-nitrocyclohexene

PDB Compounds: (K:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d3f03k_:

Sequence; same for both SEQRES and ATOM records:

>d3f03k_ c.1.4.1 (K:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
sl

Timeline for d3f03k_:

• d3f03k_ first appeared in SCOPe 2.01
  
• d3f03k_ appears in SCOPe 2.05
  
• d3f03k_ appears in SCOPe 2.07
  
• d3f03k_ appears in the current release, SCOPe 2.08