Lineage for d9gssb1 (9gss B:77-209)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 214038Protein Class pi GST [81347] (3 species)
  7. 214039Species Human (Homo sapiens) [TaxId:9606] [47619] (33 PDB entries)
  8. 214058Domain d9gssb1: 9gss B:77-209 [17537]
    Other proteins in same PDB: d9gssa2, d9gssb2
    complexed with gtx, mes, so4

Details for d9gssb1

PDB Entry: 9gss (more details), 1.9 Å

PDB Description: human glutathione s-transferase p1-1, complex with s-hexyl glutathione

SCOP Domain Sequences for d9gssb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9gssb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d9gssb1:

Click to download the PDB-style file with coordinates for d9gssb1.
(The format of our PDB-style files is described here.)

Timeline for d9gssb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d9gssb2