SCOPe 2.07: Domain d3ezsb_: 3ezs B:

Lineage for d3ezsb_ (3ezs B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [188666] (10 PDB entries)

8. Domain d3ezsb_: 3ezs B: [175342]
   Other proteins in same PDB: d3ezsa2
   automated match to d2gb3e1
   complexed with edo, po4

Details for d3ezsb_

PDB Entry: 3ezs, 2.19 Å

PDB Description: crystal structure of aminotransferase aspb (np_207418.1) from helicobacter pylori 26695 at 2.19 a resolution

PDB Compounds: (B:) aminotransferase AspB

SCOPe Domain Sequences for d3ezsb_:

Sequence; same for both SEQRES and ATOM records:

>d3ezsb_ c.67.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mtfepypferlrallkeitpkkrgldlgigepqfetpkfiqdalknhthslniypksafe
eslraaqrgffkrrfkielkenelistlgsrevlfnfpsfvlfdyqnptiaypnpfyqiy
egaakfikaksllmpltkendftpslnekelqevdlvilnspnnptgrtlsleeliswvk
lalkhdfilindecyseiyentpppslleacmlagneafknvlvihslskrssapglrsg
fiagdsrllekykafraylgytsanaiqkaseaawlddrhaeffrniyannlklarkifk
ntliypysfyvylpvqngenfaktlyqnegiitlpalylgrnrigadyvrlalvydtpll
ekpleiietyrenh

Timeline for d3ezsb_:

• d3ezsb_ first appeared in SCOPe 2.01
  
• d3ezsb_ appears in SCOPe 2.06
  
• d3ezsb_ appears in the current release, SCOPe 2.08