Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [188666] (10 PDB entries) |
Domain d3ezsb_: 3ezs B: [175342] Other proteins in same PDB: d3ezsa2 automated match to d2gb3e1 complexed with edo, po4 |
PDB Entry: 3ezs (more details), 2.19 Å
SCOPe Domain Sequences for d3ezsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezsb_ c.67.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]} mtfepypferlrallkeitpkkrgldlgigepqfetpkfiqdalknhthslniypksafe eslraaqrgffkrrfkielkenelistlgsrevlfnfpsfvlfdyqnptiaypnpfyqiy egaakfikaksllmpltkendftpslnekelqevdlvilnspnnptgrtlsleeliswvk lalkhdfilindecyseiyentpppslleacmlagneafknvlvihslskrssapglrsg fiagdsrllekykafraylgytsanaiqkaseaawlddrhaeffrniyannlklarkifk ntliypysfyvylpvqngenfaktlyqnegiitlpalylgrnrigadyvrlalvydtpll ekpleiietyrenh
Timeline for d3ezsb_: