SCOPe 2.05: Domain d3eyja_: 3eyj A:

Lineage for d3eyja_ (3eyj A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [187142] (19 PDB entries)

8. Domain d3eyja_: 3eyj A: [175310]
   Other proteins in same PDB: d3eyjb_
   automated match to d1mqla_

Details for d3eyja_

PDB Entry: 3eyj, 2.6 Å

PDB Description: Structure of Influenza Haemagglutinin in complex with an inhibitor of membrane fusion

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3eyja_:

Sequence; same for both SEQRES and ATOM records:

>d3eyja_ b.19.1.2 (A:) automated matches {Influenza A virus [TaxId: 11320]}
gnpiiclghhavengtsvktltdnhvevvsakelvetkhtdelcpsplklvdgqdcdlin
galgspgcdrlqdttwdvfierptavdtcypfdvpdyqslrsilassgslefiaeqftwn
gvkvdgsssaclrggrnsffsrlnwltkatngnygpinvtkentgsyvrlylwgvhhpss
dneqtdlykvatgrvtvstrsdqisivpnigsrprvrnqsgrisiywtlvnpgdsiifns
ignliaprghykiskstkstvlksdkrigsctspcltdkgsiqsdkpfqnvsriaigncp
kyvkqgslmlatgmrnipg

Timeline for d3eyja_:

• d3eyja_ first appeared in SCOPe 2.01
  
• d3eyja_ appears in SCOPe 2.04
  
• d3eyja_ appears in SCOPe 2.06
  
• d3eyja_ appears in the current release, SCOPe 2.08