Lineage for d18gsb1 (18gs B:77-209)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48134Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (30 PDB entries)
  8. 48149Domain d18gsb1: 18gs B:77-209 [17529]
    Other proteins in same PDB: d18gsa2, d18gsb2

Details for d18gsb1

PDB Entry: 18gs (more details), 1.9 Å

PDB Description: glutathione s-transferase p1-1 complexed with 1-(s-glutathionyl)-2,4-dinitrobenzene

SCOP Domain Sequences for d18gsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d18gsb1 a.45.1.1 (B:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d18gsb1:

Click to download the PDB-style file with coordinates for d18gsb1.
(The format of our PDB-style files is described here.)

Timeline for d18gsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d18gsb2