Lineage for d2pgta1 (2pgt A:77-209)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153151Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (33 PDB entries)
  8. 153167Domain d2pgta1: 2pgt A:77-209 [17526]
    Other proteins in same PDB: d2pgta2, d2pgtb2

Details for d2pgta1

PDB Entry: 2pgt (more details), 1.9 Å

PDB Description: crystal structure of human glutathione s-transferase p1-1[v104] complexed with (9r,10r)-9-(s-glutathionyl)-10-hydroxy-9,10-dihydrophenanthrene

SCOP Domain Sequences for d2pgta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgta1 a.45.1.1 (A:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d2pgta1:

Click to download the PDB-style file with coordinates for d2pgta1.
(The format of our PDB-style files is described here.)

Timeline for d2pgta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pgta2