Lineage for d8gssc1 (8gss C:77-209)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281527Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 281528Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 281529Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 281725Protein Class pi GST [81347] (3 species)
  7. 281726Species Human (Homo sapiens) [TaxId:9606] [47619] (35 PDB entries)
  8. 281737Domain d8gssc1: 8gss C:77-209 [17523]
    Other proteins in same PDB: d8gssa2, d8gssb2, d8gssc2
    complexed with gtt, mes, so4

Details for d8gssc1

PDB Entry: 8gss (more details), 1.9 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione

SCOP Domain Sequences for d8gssc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8gssc1 a.45.1.1 (C:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d8gssc1:

Click to download the PDB-style file with coordinates for d8gssc1.
(The format of our PDB-style files is described here.)

Timeline for d8gssc1: