Lineage for d8gssb1 (8gss B:77-209)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3768Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (30 PDB entries)
  8. 3778Domain d8gssb1: 8gss B:77-209 [17522]
    Other proteins in same PDB: d8gssa2, d8gssb2, d8gssc2

Details for d8gssb1

PDB Entry: 8gss (more details), 1.9 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione

SCOP Domain Sequences for d8gssb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8gssb1 a.45.1.1 (B:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d8gssb1:

Click to download the PDB-style file with coordinates for d8gssb1.
(The format of our PDB-style files is described here.)

Timeline for d8gssb1: