Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class pi GST [81347] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries) |
Domain d8gssb1: 8gss B:77-209 [17522] Other proteins in same PDB: d8gssa2, d8gssb2, d8gssc2 complexed with gsh, mes, so4 |
PDB Entry: 8gss (more details), 1.9 Å
SCOPe Domain Sequences for d8gssb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8gssb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp eyvnlpingngkq
Timeline for d8gssb1:
View in 3D Domains from other chains: (mouse over for more information) d8gssa1, d8gssa2, d8gssc1, d8gssc2 |