Lineage for d3etqb_ (3etq B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963689Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 963695Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 963801Protein automated matches [190352] (5 species)
    not a true protein
  7. 963812Species Mouse (Mus musculus) [TaxId:10090] [187178] (3 PDB entries)
  8. 963814Domain d3etqb_: 3etq B: [175218]
    automated match to d1q5oa_
    complexed with cmp; mutant

Details for d3etqb_

PDB Entry: 3etq (more details), 1.9 Å

PDB Description: x-ray structure of cysteine-free fragment of mhcn2 c-terminal region from amino acids 443-630 including c508n, c584s, and c601s mutations
PDB Compounds: (B:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d3etqb_:

Sequence, based on SEQRES records: (download)

>d3etqb_ b.82.3.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplreei
vnfnnrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvvs
vltkgnkemklsdgsyfgeislltrgrrtasvradtysrlyslsvdnfnevleeypmmrr
afetvaidrldr

Sequence, based on observed residues (ATOM records): (download)

>d3etqb_ b.82.3.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplreei
vnfnnrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvvs
vltknkemklsdgsyfgeislltrgrrtasvradtysrlyslsvdnfnevleeypmmrra
fetvaidrldr

SCOPe Domain Coordinates for d3etqb_:

Click to download the PDB-style file with coordinates for d3etqb_.
(The format of our PDB-style files is described here.)

Timeline for d3etqb_: