SCOPe 2.01: Domain d3etqa_: 3etq A:

Lineage for d3etqa_ (3etq A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187178] (3 PDB entries)

8. Domain d3etqa_: 3etq A: [175217]
   automated match to d1q5oa_
   complexed with cmp; mutant

Details for d3etqa_

PDB Entry: 3etq, 1.9 Å

PDB Description: x-ray structure of cysteine-free fragment of mhcn2 c-terminal region from amino acids 443-630 including c508n, c584s, and c601s mutations

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d3etqa_:

Sequence; same for both SEQRES and ATOM records:

>d3etqa_ b.82.3.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfnnrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeislltrgrrtasvradtysrlyslsvdnfnevleeypmmr
rafetvaidrldri

Timeline for d3etqa_:

• d3etqa_ is new in SCOPe 2.01-stable
  
• d3etqa_ appears in SCOPe 2.02
  
• d3etqa_ appears in the current release, SCOPe 2.08