Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187178] (3 PDB entries) |
Domain d3etqa_: 3etq A: [175217] automated match to d1q5oa_ complexed with cmp; mutant |
PDB Entry: 3etq (more details), 1.9 Å
SCOPe Domain Sequences for d3etqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etqa_ b.82.3.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree ivnfnnrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv svltkgnkemklsdgsyfgeislltrgrrtasvradtysrlyslsvdnfnevleeypmmr rafetvaidrldri
Timeline for d3etqa_: