Lineage for d3esyc_ (3esy C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856358Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2856472Protein automated matches [190443] (6 species)
    not a true protein
  7. 2856473Species Anabaena sp. [TaxId:1168] [188238] (5 PDB entries)
  8. 2856480Domain d3esyc_: 3esy C: [175205]
    automated match to d1rcfa_
    complexed with fmn, gol

Details for d3esyc_

PDB Entry: 3esy (more details), 2.39 Å

PDB Description: e16ke61k flavodoxin from anabaena
PDB Compounds: (C:) flavodoxin

SCOPe Domain Sequences for d3esyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esyc_ c.23.5.1 (C:) automated matches {Anabaena sp. [TaxId: 1168]}
kkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnigk
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d3esyc_:

Click to download the PDB-style file with coordinates for d3esyc_.
(The format of our PDB-style files is described here.)

Timeline for d3esyc_: