SCOPe 2.01: Domain d3esgb_: 3esg B:

Lineage for d3esgb_ (3esg B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (5 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:216595] [189073] (1 PDB entry)

8. Domain d3esgb_: 3esg B: [175192]
   automated match to d1ylla1
   complexed with fmt, gol

Details for d3esgb_

PDB Entry: 3esg, 1.8 Å

PDB Description: crystal structure of hutd from pseudomonas fluorescens sbw25

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3esgb_:

Sequence; same for both SEQRES and ATOM records:

>d3esgb_ b.82.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 216595]}
saisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqr
vitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyhar
lqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrcclie
ltqrg

Timeline for d3esgb_:

• d3esgb_ is new in SCOPe 2.01-stable
  
• d3esgb_ appears in SCOPe 2.02
  
• d3esgb_ last appears in SCOPe 2.06