SCOP 1.63: Domain d1aqwc1: 1aqw C:77-209

Lineage for d1aqwc1 (1aqw C:77-209)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class pi GST [81347] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (33 PDB entries)

8. Domain d1aqwc1: 1aqw C:77-209 [17519]
   Other proteins in same PDB: d1aqwa2, d1aqwb2, d1aqwc2, d1aqwd2

Details for d1aqwc1

PDB Entry: 1aqw, 1.8 Å

PDB Description: glutathione s-transferase in complex with glutathione

SCOP Domain Sequences for d1aqwc1:

Sequence; same for both SEQRES and ATOM records:

>d1aqwc1 a.45.1.1 (C:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d1aqwc1:

• d1aqwc1 first appeared (with stable ids) in SCOP 1.55
  
• d1aqwc1 appears in SCOP 1.61
  
• d1aqwc1 appears in SCOP 1.65
  
• d1aqwc1 appears in the current release, SCOPe 2.08