SCOPe 2.05: Domain d3ersx_: 3ers X:

Lineage for d3ersx_ (3ers X:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein Structure-specific tRNA-binding protein TRBP111 [89328] (2 species)

7. Species Escherichia coli [TaxId:562] [89329] (1 PDB entry)
   YgjH

8. Domain d3ersx_: 3ers X: [175176]
   automated match to d1pxfa_

Details for d3ersx_

PDB Entry: 3ers, 1.87 Å

PDB Description: crystal structure of e. coli trbp111

PDB Compounds: (X:) tRNA-binding protein ygjH

SCOPe Domain Sequences for d3ersx_:

Sequence; same for both SEQRES and ATOM records:

>d3ersx_ b.40.4.4 (X:) Structure-specific tRNA-binding protein TRBP111 {Escherichia coli [TaxId: 562]}
metvayadfarlemrvgkivevkrhenadklyivqvdvgqktlqtvtslvpyyseeelmg
ktvvvlcnlqkakmrgetsecmllcaetddgsesvlltpermmpagvrvvld

Timeline for d3ersx_:

• d3ersx_ first appeared in SCOPe 2.01
  
• d3ersx_ appears in SCOPe 2.04
  
• d3ersx_ is called d3ersx1 in SCOPe 2.06
  
• d3ersx_ appears in the current release, SCOPe 2.08, called d3ersx1