Lineage for d3ersx_ (3ers X:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124920Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 1124947Protein Structure-specific tRNA-binding protein TRBP111 [89328] (2 species)
  7. 1124953Species Escherichia coli [TaxId:562] [89329] (1 PDB entry)
    YgjH
  8. 1124954Domain d3ersx_: 3ers X: [175176]
    automated match to d1pxfa_

Details for d3ersx_

PDB Entry: 3ers (more details), 1.87 Å

PDB Description: crystal structure of e. coli trbp111
PDB Compounds: (X:) tRNA-binding protein ygjH

SCOPe Domain Sequences for d3ersx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ersx_ b.40.4.4 (X:) Structure-specific tRNA-binding protein TRBP111 {Escherichia coli [TaxId: 562]}
metvayadfarlemrvgkivevkrhenadklyivqvdvgqktlqtvtslvpyyseeelmg
ktvvvlcnlqkakmrgetsecmllcaetddgsesvlltpermmpagvrvvld

SCOPe Domain Coordinates for d3ersx_:

Click to download the PDB-style file with coordinates for d3ersx_.
(The format of our PDB-style files is described here.)

Timeline for d3ersx_: