Lineage for d3ersx_ (3ers X:)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) 
Family b.40.4.4: Myf domain [50277] (7 proteins) 
Protein Structure-specific tRNA-binding protein TRBP111 [89328] (2 species) Species Escherichia coli [TaxId:562] [89329] (1 PDB entry)
YgjH
Domain d3ersx_: 3ers X: [175176]
automated match to d1pxfa_
Details for d3ersx_
PDB Entry: 3ers (more details), 1.87 Å
PDB Description: crystal structure of e. coli trbp111
PDB Compounds: (X:) tRNA-binding protein ygjHSCOPe Domain Sequences for d3ersx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ersx_ b.40.4.4 (X:) Structure-specific tRNA-binding protein TRBP111 {Escherichia coli [TaxId: 562]}
metvayadfarlemrvgkivevkrhenadklyivqvdvgqktlqtvtslvpyyseeelmg
ktvvvlcnlqkakmrgetsecmllcaetddgsesvlltpermmpagvrvvld
SCOPe Domain Coordinates for d3ersx_:
Click to download the PDB-style file with coordinates for d3ersx_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ersx_:
- d3ersx_ first appeared in SCOPe 2.01
- d3ersx_ appears in SCOPe 2.03
- d3ersx_ appears in the current release, SCOPe 2.08, called d3ersx1
View in 3D