SCOPe 2.04: Domain d3eqzb_: 3eqz B:

Lineage for d3eqzb_ (3eqz B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Colwellia psychrerythraea [TaxId:167879] [188634] (1 PDB entry)

8. Domain d3eqzb_: 3eqz B: [175165]
   automated match to d1nxoa_

Details for d3eqzb_

PDB Entry: 3eqz, 2.15 Å

PDB Description: crystal structure of a response regulator from colwellia psychrerythraea

PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d3eqzb_:

Sequence; same for both SEQRES and ATOM records:

>d3eqzb_ c.23.1.0 (B:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
slnrvfivdddtltcnllktivepifgnveafqhprafltlslnkqdiiildlmmpdmdg
ievirhlaehkspaslilisgydsgvlhsaetlalscglnvintftkpintevltcflts
lsnrq

Timeline for d3eqzb_:

• d3eqzb_ first appeared in SCOPe 2.01
  
• d3eqzb_ appears in SCOPe 2.03
  
• d3eqzb_ appears in SCOPe 2.05
  
• d3eqzb_ appears in the current release, SCOPe 2.08, called d3eqzb1