Lineage for d1pgta1 (1pgt A:77-209)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153151Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (33 PDB entries)
  8. 153156Domain d1pgta1: 1pgt A:77-209 [17515]
    Other proteins in same PDB: d1pgta2, d1pgtb2

Details for d1pgta1

PDB Entry: 1pgt (more details), 1.8 Å

PDB Description: crystal structure of human glutathione s-transferase p1-1[v104] complexed with s-hexylglutathione

SCOP Domain Sequences for d1pgta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgta1 a.45.1.1 (A:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d1pgta1:

Click to download the PDB-style file with coordinates for d1pgta1.
(The format of our PDB-style files is described here.)

Timeline for d1pgta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgta2