Lineage for d1bed_1 (1bed 63-126)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3663Fold a.44: Disulphide-bond formation facilitator (DSBA), insertion domain [47609] (1 superfamily)
  4. 3664Superfamily a.44.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47610] (1 family) (S)
  5. 3665Family a.44.1.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47611] (1 protein)
  6. 3666Protein Disulphide-bond formation facilitator (DSBA), insertion domain [47612] (2 species)
  7. 3692Species Vibrio cholerae [TaxId:666] [47614] (1 PDB entry)
  8. 3693Domain d1bed_1: 1bed 63-126 [17514]
    Other proteins in same PDB: d1bed_2

Details for d1bed_1

PDB Entry: 1bed (more details), 2.1 Å

PDB Description: structure of disulfide oxidoreductase

SCOP Domain Sequences for d1bed_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bed_1 a.44.1.1 (63-126) Disulphide-bond formation facilitator (DSBA), insertion domain {Vibrio cholerae}
gnmgqamskayatmialevedkmvpvmfnrihtlrkppkdeqelrqifldegidaakfda
ayng

SCOP Domain Coordinates for d1bed_1:

Click to download the PDB-style file with coordinates for d1bed_1.
(The format of our PDB-style files is described here.)

Timeline for d1bed_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bed_2