Class b: All beta proteins [48724] (174 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.0: automated matches [191599] (1 protein) not a true family |
Protein automated matches [191089] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189059] (2 PDB entries) |
Domain d3eopb_: 3eop B: [175138] automated match to d2ar1a1 complexed with so4 |
PDB Entry: 3eop (more details), 2.3 Å
SCOPe Domain Sequences for d3eopb_:
Sequence, based on SEQRES records: (download)
>d3eopb_ b.122.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} shwlmksepesrlekgvdvkfsiedlkaqpkqttcwdgvrnyqarnflramklgeeaffy hsnckepgiaglmkivkeaypdhtqfeknnphydpsskednpkwsmvdvqfvrmmkrfip laelksyhqahkatggplknmvlftrqrlsiqpltqeefdfvlsleele
>d3eopb_ b.122.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} shwlmksepdvkfsiedlkaqpkqttcwdgvrnyqarnflramklgeeaffyhsnckepg iaglmkivkeaypdhtqfeknnphydpsskednpkwsmvdvqfvrmmkrfiplaelksyh qahkatggplknmvlftrqrlsiqpltqeefdfvlsleele
Timeline for d3eopb_: