Lineage for d3eopb_ (3eop B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1335534Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1335535Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1335784Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 1335785Protein automated matches [191089] (6 species)
    not a true protein
  7. 1335800Species Human (Homo sapiens) [TaxId:9606] [189059] (2 PDB entries)
  8. 1335804Domain d3eopb_: 3eop B: [175138]
    automated match to d2ar1a1
    complexed with so4

Details for d3eopb_

PDB Entry: 3eop (more details), 2.3 Å

PDB Description: Crystal Structure of the DUF55 domain of human thymocyte nuclear protein 1
PDB Compounds: (B:) Thymocyte nuclear protein 1

SCOPe Domain Sequences for d3eopb_:

Sequence, based on SEQRES records: (download)

>d3eopb_ b.122.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shwlmksepesrlekgvdvkfsiedlkaqpkqttcwdgvrnyqarnflramklgeeaffy
hsnckepgiaglmkivkeaypdhtqfeknnphydpsskednpkwsmvdvqfvrmmkrfip
laelksyhqahkatggplknmvlftrqrlsiqpltqeefdfvlsleele

Sequence, based on observed residues (ATOM records): (download)

>d3eopb_ b.122.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shwlmksepdvkfsiedlkaqpkqttcwdgvrnyqarnflramklgeeaffyhsnckepg
iaglmkivkeaypdhtqfeknnphydpsskednpkwsmvdvqfvrmmkrfiplaelksyh
qahkatggplknmvlftrqrlsiqpltqeefdfvlsleele

SCOPe Domain Coordinates for d3eopb_:

Click to download the PDB-style file with coordinates for d3eopb_.
(The format of our PDB-style files is described here.)

Timeline for d3eopb_: