Lineage for d3eopb1 (3eop B:55-221)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824132Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 2824133Protein automated matches [191089] (10 species)
    not a true protein
  7. 2824139Species Human (Homo sapiens) [TaxId:9606] [189059] (71 PDB entries)
  8. 2824251Domain d3eopb1: 3eop B:55-221 [175138]
    Other proteins in same PDB: d3eopa2, d3eopb2
    automated match to d2ar1a1
    complexed with so4

Details for d3eopb1

PDB Entry: 3eop (more details), 2.3 Å

PDB Description: Crystal Structure of the DUF55 domain of human thymocyte nuclear protein 1
PDB Compounds: (B:) Thymocyte nuclear protein 1

SCOPe Domain Sequences for d3eopb1:

Sequence, based on SEQRES records: (download)

>d3eopb1 b.122.1.0 (B:55-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shwlmksepesrlekgvdvkfsiedlkaqpkqttcwdgvrnyqarnflramklgeeaffy
hsnckepgiaglmkivkeaypdhtqfeknnphydpsskednpkwsmvdvqfvrmmkrfip
laelksyhqahkatggplknmvlftrqrlsiqpltqeefdfvlslee

Sequence, based on observed residues (ATOM records): (download)

>d3eopb1 b.122.1.0 (B:55-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shwlmksepdvkfsiedlkaqpkqttcwdgvrnyqarnflramklgeeaffyhsnckepg
iaglmkivkeaypdhtqfeknnphydpsskednpkwsmvdvqfvrmmkrfiplaelksyh
qahkatggplknmvlftrqrlsiqpltqeefdfvlslee

SCOPe Domain Coordinates for d3eopb1:

Click to download the PDB-style file with coordinates for d3eopb1.
(The format of our PDB-style files is described here.)

Timeline for d3eopb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eopb2