SCOPe 2.08: Domain d3eopb1: 3eop B:55-221

Lineage for d3eopb1 (3eop B:55-221)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189059] (71 PDB entries)

8. Domain d3eopb1: 3eop B:55-221 [175138]
   Other proteins in same PDB: d3eopa2, d3eopb2
   automated match to d2ar1a1
   complexed with so4

Details for d3eopb1

PDB Entry: 3eop, 2.3 Å

PDB Description: Crystal Structure of the DUF55 domain of human thymocyte nuclear protein 1

PDB Compounds: (B:) Thymocyte nuclear protein 1

SCOPe Domain Sequences for d3eopb1:

Sequence, based on SEQRES records:

>d3eopb1 b.122.1.0 (B:55-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shwlmksepesrlekgvdvkfsiedlkaqpkqttcwdgvrnyqarnflramklgeeaffy
hsnckepgiaglmkivkeaypdhtqfeknnphydpsskednpkwsmvdvqfvrmmkrfip
laelksyhqahkatggplknmvlftrqrlsiqpltqeefdfvlslee

Sequence, based on observed residues (ATOM records):

>d3eopb1 b.122.1.0 (B:55-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shwlmksepdvkfsiedlkaqpkqttcwdgvrnyqarnflramklgeeaffyhsnckepg
iaglmkivkeaypdhtqfeknnphydpsskednpkwsmvdvqfvrmmkrfiplaelksyh
qahkatggplknmvlftrqrlsiqpltqeefdfvlslee

Timeline for d3eopb1:

• d3eopb1 first appeared in SCOPe 2.01, called d3eopb_
  
• d3eopb1 appears in SCOPe 2.07