SCOPe 2.02: Domain d3eopa_: 3eop A:

Lineage for d3eopa_ (3eop A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189059] (1 PDB entry)

8. Domain d3eopa_: 3eop A: [175137]
   automated match to d2ar1a1
   complexed with so4

Details for d3eopa_

PDB Entry: 3eop, 2.3 Å

PDB Description: Crystal Structure of the DUF55 domain of human thymocyte nuclear protein 1

PDB Compounds: (A:) Thymocyte nuclear protein 1

SCOPe Domain Sequences for d3eopa_:

Sequence; same for both SEQRES and ATOM records:

>d3eopa_ b.122.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shwlmksepesrlekgvdvkfsiedlkaqpkqttcwdgvrnyqarnflramklgeeaffy
hsnckepgiaglmkivkeaypdhtqfeknnphydpsskednpkwsmvdvqfvrmmkrfip
laelksyhqahkatggplknmvlftrqrlsiqpltqeefdfvlsleele

Timeline for d3eopa_:

• d3eopa_ first appeared in SCOPe 2.01
  
• d3eopa_ appears in SCOPe 2.03
  
• d3eopa_ appears in the current release, SCOPe 2.08, called d3eopa1