Lineage for d3eofa1 (3eof A:1-247)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963447Species Bacteroides fragilis [TaxId:272559] [188633] (1 PDB entry)
  8. 2963448Domain d3eofa1: 3eof A:1-247 [175116]
    Other proteins in same PDB: d3eofa2
    automated match to d1zcha1
    complexed with fmn

Details for d3eofa1

PDB Entry: 3eof (more details), 1.99 Å

PDB Description: crystal structure of putative oxidoreductase (yp_213212.1) from bacteroides fragilis nctc 9343 at 1.99 a resolution
PDB Compounds: (A:) Putative oxidoreductase

SCOPe Domain Sequences for d3eofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eofa1 d.90.1.0 (A:1-247) automated matches {Bacteroides fragilis [TaxId: 272559]}
mmdtvknrrtirkyqqkditpdllndlletsfrastmggmqlysvvvtrdaekkeilspa
hfnqpmvkeapvvltfcadfrrfckycqernavpgygnlmsflnaamdtllvaqtfctla
eeaglgicylgtttynpqmiidalhlpelvfpittvtvgypaespkqvdrlpiegiihee
syhdytaedinrlyaykeslpenklfieenqketlpqvftdvrytkkdnefmsenllkvl
rrqgfmd

SCOPe Domain Coordinates for d3eofa1:

Click to download the PDB-style file with coordinates for d3eofa1.
(The format of our PDB-style files is described here.)

Timeline for d3eofa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eofa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3eofb_