Lineage for d3eoaj_ (3eoa J:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500089Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 2500090Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
    Uniprot P20701 153-334
  8. 2500130Domain d3eoaj_: 3eoa J: [175115]
    Other proteins in same PDB: d3eoaa1, d3eoaa2, d3eoal1, d3eoal2
    automated match to d1lfaa_

Details for d3eoaj_

PDB Entry: 3eoa (more details), 2.8 Å

PDB Description: Crystal structure the Fab fragment of Efalizumab in complex with LFA-1 I domain, Form I
PDB Compounds: (J:) Integrin alpha-L

SCOPe Domain Sequences for d3eoaj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eoaj_ c.62.1.1 (J:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki

SCOPe Domain Coordinates for d3eoaj_:

Click to download the PDB-style file with coordinates for d3eoaj_.
(The format of our PDB-style files is described here.)

Timeline for d3eoaj_: