SCOPe 2.02: Domain d3en3a_: 3en3 A:

Lineage for d3en3a_ (3en3 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein automated matches [190140] (9 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (22 PDB entries)

8. Domain d3en3a_: 3en3 A: [175095]
   automated match to d1ftja_
   complexed with kai

Details for d3en3a_

PDB Entry: 3en3, 2.43 Å

PDB Description: crystal structure of the glur4 ligand-binding domain in complex with kainate

PDB Compounds: (A:) Glutamate receptor 4,Glutamate receptor

SCOPe Domain Sequences for d3en3a_:

Sequence; same for both SEQRES and ATOM records:

>d3en3a_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkygar
dadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlakqteiaygtldsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrks
kgkfafllestmneyteqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklsea
gvldklknkwwydkgec

Timeline for d3en3a_:

• d3en3a_ first appeared in SCOPe 2.01
  
• d3en3a_ appears in SCOPe 2.03
  
• d3en3a_ appears in the current release, SCOPe 2.08